RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · SPECIFICATIONS AND PRICES REQUIRE FINAL CONFIRMATION Learn more

PEPTIDES BIO / MATERIAL RECORD

Cagrilintide 10mg

Research-use peptide material record: pack format, specifications and COA/SDS request for qualified laboratory review.

RESEARCH USE ONLYRUO

Cagrilintide 10mg

Purity / identity≥99% purity
Molecular weight4409.01 g/mol
Pack size10mg

Volume pricing

Configured totals update at each quantity threshold.

Configured total$74.69
Open COA / MSDS
SKU: ps-cagrilintide-10mg

Research record

Pending manual confirmation

Research overview

Cagrilintide 10mg research material is supplied for laboratory research use only. This record covers the current pack format, specification fields, and documentation workflow. Cagrilintide is a novel long‑acting acylated amylin analogue that functions as a dual agonist at the amylin receptor (AMYR) and the calcitonin receptor (CTR). Native amylin is a neuroendocrine hormone secreted by pancreatic β‑cells and plays a critical role in glucose homeostasis and energy balance. Its physiological effects include delaying gastric emptying, suppressing postprandial glucagon secretion, and promoting satiety. Cagrilintide overcomes the rapid clearance of native amylin through acylation modification. It acts via a multifaceted mechanism, involving binding to and activating amylin and calcitonin receptors in key brain regions involved in appetite control, such as the area postrema and the hypothalamus. Structural studies have revealed that Cagrilintide adopts a similar "side‑channel" binding mode at both AMY1R and CTR. Key molecular features include anchoring of the F23 residue within the receptor transmembrane bundle, an intramolecular salt bridge between E14 and R17 that stabilizes the helical structure, and interaction of the C‑terminal P37 with the receptor extracellular domain (ECD). Furthermore, cryo‑electron microscopy (cryo‑EM) structural analysis has provided detailed insights into Cagrilintide binding to Gs‑coupled active AMY1R, AMY2R, AMY3R, and CTR.

Research reference

Product FAQ

What is Cagrilintide?

Cagrilintide is a long‑acting analogue of pancreatic amylin. By mimicking the physiological actions of native amylin, it targets both the amylin receptor and the calcitonin receptor—hence its classification as a dual amylin and calcitonin receptor agonist (DACRA)—to regulate appetite and energy metabolism.

Unlike commonly used GLP‑1 receptor agonists (e.g., semaglutide), Cagrilintide acts through an independent pathway. Therefore, it may be used as a monotherapy or in combination with GLP‑1‑based agents to enhance weight‑loss efficacy.

What is the purity standard for Cagrilintide?

The purity of our Cagrilintide products is ≥99%. Each batch is independently tested by a third‑party laboratory using HPLC and mass spectrometry (MS), and a complete Certificate of Analysis (COA) is provided for each batch.

Is Cagrilintide used for treating humans?

No. The Cagrilintide sold on our website is a research-grade product, intended solely for use in in vitro laboratory research and not for human injection, clinical treatment, or any commercial applications. Cagrilintide is still in the clinical research stage and has not yet been approved for commercial use as a drug.

How should Cagrilintide be stored?

The freeze‑dried powder can be stored at room temperature (in its original packaging) for several days to several weeks. For long‑term storage, it is recommended to freeze at ‑20°C and protect from light. After reconstitution, it should be stored refrigerated (at 4°C) and should not be frozen.

What research areas is Cagrilintide used for?

Yes. Cagrilintide monotherapy produces a meaningful weight-loss effect (−12% at 68 weeks in REDEFINE-1) and is appropriate for amylin-· Obesity and weight management

· Type 2 diabetes and glycemic control

· Appetite and energy intake regulation

· Non‑alcoholic fatty liver disease (NAFLD)

· Cardiovascular risk factors (e.g., blood lipids, blood pressure)receptor mechanistic research. However, for most modern obesity research, the combination protocol is more representative of likely clinical deployment.

Data sheet

Manual confirmation
Material Type
Single material
Purity Identity
≥99% purity
Molecular Weight
4409.01 g/mol
Pack Size
10mg
Molecular Formula
C194H312N54O59S2
CAS Number
1415456-99-3
Amino Acid Sequence
{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
PubChem CID
171397054
Storage conditions overview
Storage typeLong-termTemperature-80°CDuration2-3 yearsNotesSealed, dark, minimal opening
Storage typeStandardTemperature-20°CDuration1-2 yearsNotesSealed, dark, moisture-proof
Storage typeShort-termTemperature4°CDuration1-2 weeksNotesTemporary storage, use promptly
Storage typeWorking SolutionTemperature4°CDuration1-7 daysNotesReconstituted, short-term, avoid freeze-thaw

Related research guides

Review before you request.