Quality & Documentation
PEPTIDES BIO / MATERIAL RECORD
Cagrilintide 5mg
Research-use peptide material record: pack format, specifications and COA/SDS request for qualified laboratory review.
RESEARCH USE ONLYRUO
Cagrilintide 5mg
Important NoticeThis product is for use only in vitro research. It is strictly prohibited for human injection, clinical treatment, food addition or any animal experiments. Please read our terms and conditions carefully before placing an order.
Volume pricing
Configured totals update at each quantity threshold.
Configured total$38.05
Request COA / MSDS
Research record
Pending manual confirmationResearch overview
Cagrilintide is a novel long‑acting acylated amylin analogue that functions as a dual agonist at the amylin receptor (AMYR) and the calcitonin receptor (CTR). Native amylin is a neuroendocrine hormone secreted by pancreatic β‑cells and plays a critical role in glucose homeostasis and energy balance. Its physiological effects include delaying gastric emptying, suppressing postprandial glucagon secretion, and promoting satiety. Cagrilintide overcomes the rapid clearance of native amylin through acylation modification. It acts via a multifaceted mechanism, involving binding to and activating amylin and calcitonin receptors in key brain regions involved in appetite control, such as the area postrema and the hypothalamus. Structural studies have revealed that Cagrilintide adopts a similar "side‑channel" binding mode at both AMY1R and CTR. Key molecular features include anchoring of the F23 residue within the receptor transmembrane bundle, an intramolecular salt bridge between E14 and R17 that stabilizes the helical structure, and interaction of the C‑terminal P37 with the receptor extracellular domain (ECD). Furthermore, cryo‑electron microscopy (cryo‑EM) structural analysis has provided detailed insights into Cagrilintide binding to Gs‑coupled active AMY1R, AMY2R, AMY3R, and CTR.
Research reference
Product FAQ
What is Cagrilintide?
Cagrilintide is a long‑acting analogue of pancreatic amylin. By mimicking the physiological actions of native amylin, it targets both the amylin receptor and the calcitonin receptor—hence its classification as a dual amylin and calcitonin receptor agonist (DACRA)—to regulate appetite and energy metabolism.
Unlike commonly used GLP‑1 receptor agonists (e.g., semaglutide), Cagrilintide acts through an independent pathway. Therefore, it may be used as a monotherapy or in combination with GLP‑1‑based agents to enhance weight‑loss efficacy.
What is the purity standard for Cagrilintide?
The purity of our Cagrilintide products is ≥99%. Each batch is independently tested by a third‑party laboratory using HPLC and mass spectrometry (MS), and a complete Certificate of Analysis (COA) is provided for each batch.
Is Cagrilintide used for treating humans?
No. The Cagrilintide sold on our website is a research-grade product, intended solely for use in in vitro laboratory research and not for human injection, clinical treatment, or any commercial applications. Cagrilintide is still in the clinical research stage and has not yet been approved for commercial use as a drug.
How should Cagrilintide be stored?
The freeze‑dried powder can be stored at room temperature (in its original packaging) for several days to several weeks. For long‑term storage, it is recommended to freeze at ‑20°C and protect from light. After reconstitution, it should be stored refrigerated (at 4°C) and should not be frozen.
What research areas is Cagrilintide used for?
· Obesity and weight management
· Type 2 diabetes and glycemic control
· Appetite and energy intake regulation
· Non‑alcoholic fatty liver disease (NAFLD)
· Cardiovascular risk factors (e.g., blood lipids, blood pressure)
Data sheet
Manual confirmation- Material Type
- Single material
- Purity Identity
- ≥99% purity
- Molecular Weight
- 4409.01 g/mol
- Pack Size
- 5mg
- Molecular Formula
- C194H312N54O59S2
- CAS Number
- 1415456-99-3
- Amino Acid Sequence
- {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
- PubChem CID
- 171397054
- Storage conditions overview
- Storage typeLong-termTemperature-80°CDuration2-3 yearsNotesSealed, dark, minimal openingStorage typeStandardTemperature-20°CDuration1-2 yearsNotesSealed, dark, moisture-proofStorage typeShort-termTemperature4°CDuration1-2 weeksNotesTemporary storage, use promptlyStorage typeWorking SolutionTemperature4°CDuration1-7 daysNotesReconstituted, short-term, avoid freeze-thaw00
Related research guides
Review before you request.
Laboratory Records
Cagrilintide: Structural-Source Context and Material Documentation Review
A research-use-only review of a defined Cagrilintide receptor-complex source and separate documentation for received materials.Read guideResearch Models & Evidence